Blog

Overview

Nicotinamide adenine dinucleotide (NAD+) is a dinucleotide coenzyme present in all living cells, functioning as both an essential redox carrier in cellular respiration and a substrate for multiple enzyme classes that consume NAD+ catalytically. The ratio of NAD+ to its reduced form NADH is a key indicator of cellular metabolic state and redox balance. Unlike most cofactors, NAD+ is not merely recycled but actively consumed and regenerated through dedicated biosynthetic pathways, making NAD+ availability a regulated variable with downstream consequences for cellular function and longevity.

Roles in Energy Metabolism

In oxidative phosphorylation, NAD+ accepts electrons from glycolysis, the citric acid cycle, and fatty acid oxidation, being reduced to NADH. NADH then donates electrons to Complex I of the mitochondrial electron transport chain, driving ATP synthesis via the proton gradient. In the cytoplasm, NAD+/NADH cycling in glycolysis is critical for glucose flux — impairment of NAD+ regeneration rapidly limits glycolytic rate.

The cytoplasmic NAD+/NADH ratio (~700:1) and the mitochondrial ratio (~8:1) are maintained at vastly different setpoints, reflecting compartmentalised redox balance. Disruption of either ratio impairs metabolic flexibility and is associated with mitochondrial dysfunction in aged cells.

Sirtuin Deacylases: NAD+ as a Substrate

Sirtuins (SIRT1–7) are a family of NAD+-dependent deacylases that remove acetyl (and other acyl) groups from lysine residues of histone and non-histone proteins, consuming one molecule of NAD+ per deacylation cycle (producing nicotinamide and 2′-O-acetyl-ADP-ribose as by-products). Because sirtuins are kinetically dependent on NAD+ concentration, cellular NAD+ availability directly gates sirtuin activity.

SIRT1 and SIRT3 (cytoplasmic/nuclear and mitochondrial, respectively) are the most studied in longevity and metabolic research. SIRT1 activates PGC-1α (driving mitochondrial biogenesis), deacetylates FOXO transcription factors (promoting stress resistance genes), and modulates NF-κB activity (anti-inflammatory). Reduced NAD+ availability in senescent cells attenuates SIRT1 activity, contributing to the senescence-associated transcriptional programme.

PARP Activation and NAD+ Consumption in Genotoxic Stress

Poly(ADP-ribose) polymerases (PARPs), particularly PARP1, use NAD+ to synthesise poly-ADP-ribose (PAR) chains on target proteins as part of the DNA damage response. PARP1 activation is highly NAD+-consumptive — extensive DNA damage can trigger PARP1 hyperactivation that depletes cellular NAD+ within minutes, leading to energetic collapse and cell death (parthanatos). In cell culture models of oxidative stress and genotoxicity, NAD+ depletion via PARP hyperactivation is a well-characterised mechanism of cytotoxicity.

Supplementation of cell culture media with NAD+ precursors (NMN, NR, niacin) rescues PARP1-induced NAD+ depletion and restores cellular ATP levels and viability in these models, providing a causal link between NAD+ availability and DNA damage response outcomes.

NAD+ Decline in Senescence and Aging Models

NAD+ levels decline in aged tissues across multiple model systems — in rodents, aged C. elegans, and primary human cell cultures from older donors. Multiple mechanisms contribute: reduced expression of NAMPT (the rate-limiting enzyme in the salvage pathway that regenerates NAD+ from nicotinamide), increased CD38 expression (a NAD+ hydrolase that rises with age and inflammatory activation), and increased PARP1 activity driven by accumulated DNA damage.

In replicatively senescent human fibroblasts, NAD+ levels fall 30–50% compared to proliferating controls, correlating with reduced SIRT1 activity and upregulated NF-κB-driven senescence-associated secretory phenotype (SASP) gene expression. NAD+ supplementation in these senescent cell cultures partially normalises SIRT1 activity and attenuates SASP marker expression in several published studies.

In Vitro Research Applications

NAD+ and its precursors (NMN, NR) are extensively used in cell culture to: (1) rescue NAD+ depletion in genotoxic stress models; (2) activate sirtuin pathways in metabolic research; (3) model interventions in senescence assays (NAD+ supplementation as a positive control); and (4) study mitochondrial function in aged primary cell cultures. Exogenous NAD+ is taken up by cells via connexin 43 hemichannels and other transporters, while precursors NMN and NR are converted intracellularly to NAD+ via NMNAT enzymes.

Concentration ranges used in cell culture typically span 0.1–1 mM for NAD+ and NMN, calibrated to achieve physiological intracellular NAD+ levels without osmotic artefacts from high-concentration supplementation.

For research use only. Not for human consumption. All Stackpure NAD+ is supplied with a third-party COA confirming identity and purity by HPLC.

Overview

Gonadorelin (also written gonadotrophin-releasing hormone, GnRH) is a decapeptide (pGlu-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2) produced by hypothalamic GnRH neurons and released in a pulsatile pattern into the hypothalamo-pituitary portal system. It is the master regulator of the hypothalamic-pituitary-gonadal (HPG) axis, controlling luteinising hormone (LH) and follicle-stimulating hormone (FSH) secretion from anterior pituitary gonadotrophs. Synthetic gonadorelin is structurally identical to the endogenous form, making it the reference agonist in GnRH receptor research.

GnRH Receptor Binding and Signalling

The GnRH receptor (GnRHR) is a Gαq/11-coupled, seven-transmembrane G protein-coupled receptor expressed predominantly on anterior pituitary gonadotroph cells. Gonadorelin binding activates phospholipase C-β, generating IP3 and DAG, which releases intracellular Ca2+ from ER stores and activates PKC. The resulting Ca2+ transient and PKC activation drive LH and FSH exocytosis from secretory granules.

Binding assays report gonadorelin Ki values of approximately 0.5–2 nM at human GnRHR, with near-full agonist activity (Emax comparable to the endogenous ligand). Unlike many GPCR systems, GnRHR lacks the C-terminal tail typically involved in β-arrestin recruitment and receptor internalisation, producing unusually slow desensitisation kinetics that are directly relevant to the frequency-dependent signalling described below.

Pulsatile vs Continuous Stimulation: The Frequency Code

The HPG axis is uniquely sensitive to GnRH pulse frequency. Pulsatile gonadorelin exposure (typically 1 pulse per 60–120 minutes physiologically) maintains LH and FSH secretion and supports gonadal steroidogenesis. Continuous, non-pulsatile GnRH receptor stimulation paradoxically suppresses LH and FSH release — the mechanism exploited therapeutically by GnRH superagonists (leuprolide, buserelin) for medical castration.

In perifusion assays of dispersed anterior pituitary cells, pulsatile gonadorelin at 60-minute intervals maintains robust, reproducible LH pulses over 24+ hours. Continuous infusion of equivalent total GnRH dose produces initial stimulation followed by progressive desensitisation and LH suppression by 4–8 hours. This frequency-encoding property makes gonadorelin invaluable as a research tool for studying pituitary gonadotroph responsiveness, receptor dynamics, and G protein signalling kinetics.

Differential LH and FSH Regulation

Gonadorelin differentially regulates LH and FSH secretion in a frequency-dependent manner. High-frequency GnRH pulses (every 30 minutes) preferentially drive LH release, while low-frequency pulses (every 120–240 minutes) favour FSH secretion. This differential sensitivity is mediated at least partly through divergent activation of downstream transcription factors (Egr-1 for LH-β vs AP-1 and SF-1 for FSH-β) and differential calcium signalling profiles.

Cell-based assays using gonadotroph-lineage LβT2 cells (a murine gonadotroph cell model) have been instrumental in characterising these frequency-response curves and the intracellular signalling cascades mediating them.

Applications in Reproductive Neuroendocrinology Research

Gonadorelin is used as both a tool compound and a physiological mimic in HPG axis research. It is employed to: (1) characterise GnRH receptor expression and signalling in cell lines and primary cultures; (2) probe gonadotroph responsiveness in contexts of receptor downregulation or upstream hypogonadism; (3) model pulsatile HPG axis dynamics in ex vivo pituitary systems; and (4) study interactions between the HPG and HPA axes.

When studying endogenous GnRH interactors — including kisspeptin, neurokinin B, and dynorphin (the KNDy neuron system that drives pulsatile GnRH release) — exogenous gonadorelin provides a downstream reference signal to dissociate upstream pulsatility defects from downstream gonadotroph responsiveness.

Stability and Research Use Considerations

Gonadorelin is susceptible to rapid proteolytic cleavage in plasma and cell culture media, with a biological half-life of 2–10 minutes. For in vitro research, frequent media changes or microfluidic perfusion systems are required to accurately model pulsatile exposure paradigms. Lyophilised gonadorelin is stable for extended periods when stored at -20°C; reconstituted solutions should be used promptly and not repeatedly freeze-thawed.

For research use only. Not for human consumption. All Stackpure peptides carry a third-party COA confirming ≥99% purity by HPLC.

Overview

Growth hormone-releasing peptides (GHRPs) are synthetic hexapeptides and related compounds that mimic the endogenous ghrelin hormone at the GHS-R1a receptor. GHRP-2 (D-Ala-D-β-Nal-Ala-Trp-D-Phe-Lys-NH2) and GHRP-6 (His-D-Trp-Ala-Trp-D-Phe-Lys-NH2) were among the earliest characterised synthetic GHRPs and remain foundational reference compounds in growth hormone secretagogue research. Despite sharing the same primary receptor target, their pharmacological profiles diverge in clinically meaningful ways.

GHS-R1a Receptor Binding

Both GHRP-2 and GHRP-6 bind GHS-R1a with high affinity. Radioligand competition assays report IC50 values of approximately 0.3–1 nM for GHRP-2 and 2–5 nM for GHRP-6, indicating GHRP-2’s superior binding affinity at the primary receptor. GHS-R1a is a Gαq-coupled receptor; agonist binding triggers IP3 generation, intracellular Ca2+ release, and PKC activation in pituitary somatotroph cells, culminating in GH secretion.

In cell-based calcium flux assays using GHS-R1a-transfected HEK293 cells, GHRP-2 produces greater maximum calcium responses than GHRP-6 at equimolar concentrations, consistent with its higher binding affinity.

Cortisol and ACTH Co-Release

A key distinguishing feature is GHRP-2’s more pronounced stimulation of ACTH and cortisol release relative to GHRP-6. Studies in human subjects show GHRP-2 administered intravenously produces significant ACTH and cortisol elevation alongside GH release, an effect attributed to GHS-R1a activation in hypothalamic CRH neurons and direct pituitary corticotroph stimulation. GHRP-6 produces substantially less ACTH/cortisol co-stimulation at equivalent doses in comparative studies, making it a cleaner model compound for isolated somatotroph research.

For in vitro experiments specifically examining somatotroph biology in isolation, GHRP-6 is therefore often preferred to minimise confounding HPA axis activation in mixed pituitary cell cultures.

Prolactin Stimulation

GHRP-2 also exhibits greater prolactin-stimulating activity than GHRP-6, an effect mediated at least partially through dopaminergic pathways and direct lactotroph GHS-R1a activation. This is a relevant variable in research designs using mixed anterior pituitary cell populations where prolactin secretion is monitored as a readout.

Appetite and Orexigenic Activity

Peripheral GHS-R1a activation — particularly in hypothalamic arcuate nucleus NPY/AgRP neurons — drives orexigenic signalling. Both GHRP-2 and GHRP-6 activate this pathway, but GHRP-6 has historically been characterised as producing stronger acute appetite stimulation in animal studies, possibly related to differences in blood-brain barrier penetration and hypothalamic receptor pharmacology. This property makes GHRP-6 a commonly used tool compound in hypothalamic appetite research.

Cytoprotective and Non-Somatotropic Activity

GHS-R1a-independent cytoprotective effects have been described for both peptides. GHRP-2 has been studied in cardiac ischaemia-reperfusion models where it reduces apoptosis markers (cleaved caspase-3, cytochrome c release) in cardiomyocyte cultures independent of pituitary GH release. Similar cardioprotective observations exist for GHRP-6. These effects appear to involve a distinct, non-GHS-R1a receptor (sometimes termed CD36 or related scavenger receptors) though this remains an active area of mechanistic research.

Research Protocol Considerations

When designing experiments where isolated somatotroph GH secretion is the primary endpoint, GHRP-6’s lower cortisol and prolactin co-stimulation makes it a cleaner research tool. When studying the full spectrum of GHS-R1a signalling — including HPA axis effects — GHRP-2’s broader hormonal profile provides richer physiological modelling. Both are commonly combined with GHRH analogues (CJC-1295, sermorelin) to achieve synergistic GH secretion in research models.

For research use only. Not for human consumption. All Stackpure peptides carry a third-party COA confirming ≥99% purity by HPLC.

Overview

Follistatin (FST) is a single-chain monomeric glycoprotein encoded by the FST gene. The 344 amino acid isoform (FST-344) is the predominant circulating form and the subject of most in vitro research due to its high-affinity binding of activin, myostatin (GDF-8), and related TGF-β superfamily members. First identified as a follicle-stimulating hormone-suppressing protein, FST-344 has since been characterised as a broad antagonist of multiple growth-regulating ligands with particular relevance to skeletal muscle biology.

Mechanism: High-Affinity Ligand Binding

Follistatin-344 neutralises its ligands by forming stable, non-signalling complexes that prevent receptor engagement. The crystal structure of the FST-activin A complex reveals that FST wraps around the ligand in an embrace-like configuration, burying the type I and type II receptor binding surfaces. Binding affinities (Kd) of FST-344 for myostatin and activin A fall in the picomolar to low nanomolar range in cell-free assays, making it one of the most potent endogenous antagonists of these pathways characterised.

Myostatin (GDF-8) is the primary negative regulator of skeletal muscle mass, signalling through ActRIIB and ALK4/5 receptors to activate SMAD2/3 phosphorylation and downstream inhibition of muscle protein synthesis. FST-344 prevents myostatin from engaging ActRIIB, effectively blocking the SMAD2/3 inhibitory cascade.

In Vitro Evidence: Skeletal Muscle Cells

In C2C12 myoblast cell culture systems, treatment with recombinant FST-344 at nanomolar concentrations consistently increases myotube diameter, myonuclei number, and markers of differentiation (MyoD, myogenin) compared to untreated controls. The effect is partially attributable to myostatin neutralisation and partially to activin A antagonism, as dual neutralisation produces additive increases in hypertrophic markers above either target alone.

Satellite cell (muscle stem cell) proliferation assays show enhanced BrdU incorporation and reduced apoptosis markers following FST-344 treatment, suggesting a role in supporting regenerative capacity beyond simple myostatin blockade.

Activin A and Systemic Wasting

Activin A contributes to skeletal muscle atrophy in cachexia and age-related sarcopenia models. FST-344’s ability to neutralise activin A in addition to myostatin positions it as a dual-target antagonist of catabolic signalling. Research in murine models of cancer-associated cachexia shows that FST-344 overexpression preserves lean mass at equivalent or greater levels than myostatin-specific antibodies alone, consistent with activin A playing a significant independent role in muscle wasting.

Considerations for In Vitro Research

FST-344 is a glycoprotein and requires careful handling to preserve tertiary structure and ligand-binding activity. Repeated freeze-thaw cycles, high-temperature storage, and extreme pH conditions can denature the protein and reduce binding affinity. Researchers should validate activity using cell-based myostatin neutralisation assays (e.g., SMAD2/3 phosphorylation inhibition in ActRIIB-expressing cells) when assessing lot-to-lot consistency.

Because FST-344 binds multiple TGF-β family members, interpretating results in complex cell culture systems requires appropriate controls to distinguish myostatin-specific from activin-mediated effects.

For research use only. Not for human consumption. All Stackpure peptides are supplied with a third-party COA confirming ≥99% purity by HPLC.

Overview

CJC-1295 is a synthetic analogue of growth hormone-releasing hormone (GHRH) developed to extend the half-life of endogenous GHRH (approximately 7 minutes) for research purposes. Two variants exist: CJC-1295 with Drug Affinity Complex (DAC) and CJC-1295 without DAC (also called Modified GRF 1-29 or Mod-GRF 1-29). The structural difference — a lysine-maleimide conjugate in the DAC form — produces dramatically different pharmacokinetic profiles relevant to in vitro and in vivo research design.

The Drug Affinity Complex (DAC) Technology

DAC technology covalently links the peptide to circulating albumin in biological systems, dramatically extending half-life from approximately 30 minutes (CJC-1295 no-DAC) to 6–8 days (CJC-1295 DAC). The maleimide group in DAC reacts with the free thiol of Cys-34 on human serum albumin, creating a stable thioether bond that protects the peptide from enzymatic cleavage by dipeptidyl peptidase-4 (DPP-4) and serum peptidases.

In cell-based assays, CJC-1295 DAC binds the GHRH receptor (GHRH-R) and stimulates cAMP accumulation in a dose-dependent manner. Binding affinity studies report Ki values in the low nanomolar range, comparable to native GHRH, with full agonist activity at pituitary somatotroph cell lines.

CJC-1295 No-DAC: Modified GRF 1-29

CJC-1295 no-DAC (Mod-GRF 1-29) retains the GHRH-R binding sequence but lacks the albumin-binding DAC moiety. Its half-life in biological systems is approximately 30 minutes, producing pulsatile rather than sustained GHRH receptor stimulation. This pulsatile profile is considered by some researchers to more closely mimic endogenous GHRH physiology.

The no-DAC form is susceptible to DPP-4 cleavage at the Ala-Glu bond at positions 2–3, though substitution of amino acids at positions 2, 8, 15, and 27 in Mod-GRF 1-29 (compared to native GHRH 1-29) increases enzymatic stability relative to native GHRH while retaining full receptor agonism.

Key Pharmacokinetic Comparison

Parameter	CJC-1295 DAC	CJC-1295 No-DAC
Half-life	6–8 days	~30 minutes
Albumin binding	Yes (covalent)	No
DPP-4 resistance	High	Moderate
GH release pattern	Sustained/tonic	Pulsatile
Typical research interval	Weekly/biweekly	Multiple times daily

Receptor Selectivity and Downstream Signalling

Both forms bind GHRH-R with high selectivity. Activation triggers Gs protein coupling, adenylyl cyclase stimulation, and elevated intracellular cAMP, which in turn activates protein kinase A (PKA) and downstream CREB phosphorylation — the canonical pathway for GH gene transcription and secretion in somatotroph cells.

In cell culture models, both analogues produce similar maximum cAMP responses (Emax), differing primarily in the temporal profile of receptor occupancy. Long-duration receptor activation by DAC forms raises questions around receptor desensitisation and downregulation in extended research paradigms.

Research Design Considerations

Selection between DAC and no-DAC variants depends on the research objective. For studies modelling sustained GHRH elevation, CJC-1295 DAC provides a pharmacokinetically stable background. For studies examining pulsatile GH secretion kinetics, or where tightly controlled on/off receptor modulation is required, the no-DAC form offers greater temporal control.

When used in combination with GHRPs such as ipamorelin or GHRP-6, the no-DAC form is commonly employed to synchronise GHRH and GHRP pulses, mimicking the natural synergistic co-secretion pattern observed physiologically.

Stability and Storage

Lyophilised CJC-1295 (both forms) is stable at room temperature for short periods but should be stored at -20°C for long-term retention of biological activity. Reconstituted solutions should be refrigerated at 2–8°C and used within 28 days. The DAC form is generally considered marginally more stable post-reconstitution due to its albumin-binding properties, though this advantage is irrelevant in cell-free assay systems.

For research use only. Not for human consumption. All Stackpure peptides carry a third-party COA confirming ≥99% purity by HPLC.

What is Kisspeptin?

Kisspeptin is a family of neuropeptides encoded by the KISS1 gene, initially identified as a metastasis suppressor in 1996 before its role in reproductive neuroendocrinology was established in 2003. The precursor kisspeptin-145 is cleaved into biologically active fragments: kisspeptin-54 (the principal circulating form), kisspeptin-14, kisspeptin-13, and kisspeptin-10. All active forms share a C-terminal RF-amide sequence essential for receptor binding.

Kisspeptin signals primarily through the G-protein coupled receptor KISS1R (formerly known as GPR54), expressed in hypothalamic GnRH neurons, the anterior pituitary, and peripheral reproductive tissues. KISS1R activation triggers GnRH pulse generation — the upstream trigger for LH and FSH secretion from the pituitary — making kisspeptin the master regulator of the hypothalamic-pituitary-gonadal (HPG) axis.

For research use only. Not for human consumption. All findings cited derive from pre-clinical in vitro, ex vivo, or animal models.

Mechanism: HPG Axis Activation

In GT1-7 hypothalamic neuron cultures, kisspeptin-10 (kp-10) at concentrations of 0.1-10 nM potently increases intracellular calcium via KISS1R-Gq-PLCbeta signalling, leading to GnRH peptide secretion within minutes. This calcium-dependent exocytosis mechanism has been confirmed by electrophysiological recordings showing rapid burst firing in GnRH neurons following kisspeptin exposure.

Pulsatile vs Continuous Exposure

The GnRH pulse pattern is critical for downstream pituitary responsiveness. In hypothalamic explant preparations, pulsatile kisspeptin application (1 nM, 2-minute pulses every 60 minutes) maintains GnRH secretion rhythmicity and preserves pituitary LH responsiveness. Continuous kisspeptin exposure leads to KISS1R desensitisation and GnRH pulse suppression — an important consideration in the design of kisspeptin-based research protocols.

Gonadal Effects in Pre-Clinical Models

In Leydig cell cultures, kisspeptin-10 (1-100 nM) enhances LH-stimulated testosterone biosynthesis via upregulation of steroidogenic acute regulatory protein (StAR) and CYP17A1 enzyme expression. In ovarian granulosa cell cultures, kisspeptin promotes oestradiol synthesis and LH receptor upregulation, findings consistent with a direct ovarian role complementary to its central HPG axis action.

Reproductive Axis Research Applications

Kisspeptin research has direct applications in the study of HPG axis regulation, hypogonadotropic hypogonadism models, and polycystic ovary syndrome (PCOS) research frameworks. In rodent models of hypothalamic amenorrhoea induced by caloric restriction, kisspeptin administration restored GnRH pulse frequency and LH pulsatility, suggesting a nutrient-sensing role at the neuroendocrine level.

Kisspeptin Research Formats at Stackpure

• Kisspeptin Peptide Vial – lyophilised for reconstitution in sterile saline or PBS
• Kisspeptin Nasal Spray – pre-formulated research solution
• Kisspeptin Pre-Mixed Peptide – ready-to-use concentration
• Kisspeptin + PT-141 Stack – combinatorial sexual health research stack

Key References

• Lee JH et al. (1996). Identification of a novel SNP in the promoter of the KISS1 gene: a potential role in infertility. Oncogene, 13(9):1958-1964.
• de Roux N et al. (2003). Hypogonadotropic hypogonadism due to loss of function of the KiSS1-derived peptide receptor GPR54. PNAS, 100(19):10972-10976.
• Navarro VM et al. (2004). Characterisation of the potent luteinising hormone-releasing activity of KiSS-1 peptide, the natural ligand of GPR54. Endocrinology, 146(1):156-163.
• Skorupskaite K et al. (2014). The kisspeptin-GnRH pathway in human reproductive health and disease. Human Reproduction Update, 20(4):485-500.

All content is for in vitro research reference only. Not for human or veterinary use. Not evaluated by FDA or any regulatory authority.

What is Thymosin Alpha-1?

Thymosin Alpha-1 (Ta1) is a 28-amino acid peptide originally isolated from thymic tissue by Allan Goldstein in the 1970s. It is derived from the N-terminal region of prothymosin alpha, a 111-amino acid precursor protein. Ta1 is now chemically synthesised via solid-phase peptide synthesis and is available as thymalfasin (INN) in research and clinical settings internationally.

Unlike many immune-targeting research compounds, Thymosin Alpha-1 has an unusually well-characterised mechanism of action focused on T-lymphocyte maturation and dendritic cell activation, with a safety profile established across multiple clinical programmes.

For research use only. Not for human consumption. All findings cited derive from in vitro or animal pre-clinical models unless otherwise specified.

Mechanism of Action: T-Cell Maturation

Thymosin Alpha-1 acts primarily on immature T-cell precursors and mature T-cell subsets. Key mechanistic findings from in vitro and ex vivo studies include:

• Thymocyte differentiation: Ta1 promotes the differentiation of CD4-CD8- double-negative thymocytes into functional CD4+ and CD8+ single-positive T cells, a process critical for establishing adaptive immune repertoire diversity
• Th1 polarisation: In peripheral blood mononuclear cell (PBMC) cultures, Ta1 shifts the CD4+ T-helper balance toward Th1 responses, increasing IFN-gamma and IL-2 production while reducing IL-4 and IL-13 secretion
• T-regulatory cell modulation: At physiological concentrations, Ta1 has been shown to support FoxP3+ T-regulatory cell function without suppressing effector T-cell responses — a balance relevant to autoimmune research models

Dendritic Cell Activation

In monocyte-derived dendritic cell (moDC) cultures, Ta1 enhances TLR9-mediated activation pathways, upregulating co-stimulatory molecules (CD80, CD86), increasing MHC-II surface expression, and promoting IL-12p70 secretion. This effect is synergistic with CpG oligonucleotides in DC maturation assays, suggesting Ta1 may amplify pattern recognition receptor-driven immune activation in research contexts.

NK Cell and Macrophage Effects

Thymosin Alpha-1 increases natural killer (NK) cell cytotoxicity in ex vivo assays, with significant dose-dependent enhancement of NK lysis of K562 target cells at concentrations of 10-100 ng/mL. In macrophage cultures, Ta1 promotes phagocytic activity, increases ROS burst in response to PMA, and upregulates MHC-II and FcgammaR expression.

Antiviral Research Models

Ta1 has been studied extensively in antiviral research contexts. In hepatitis B and C antigen-presenting cell models, Ta1 enhanced specific T-cell responses to viral antigens and increased IFN-alpha production in plasmacytoid dendritic cells. In influenza-exposed murine models, Ta1 administration reduced viral titres in lung tissue and improved survival outcomes compared to controls, associated with augmented CD8+ cytotoxic T-lymphocyte (CTL) responses.

Research Applications and Formats at Stackpure

Stackpure provides Thymosin Alpha-1 in the following research formats:

• Thymosin Alpha-1 Peptide Vial – lyophilised for reconstitution
• Thymosin Alpha-1 Nasal Spray – pre-formulated solution
• Thymosin Alpha-1 Pre-Mixed Peptide – ready-to-use

All Stackpure Thymosin Alpha-1 is verified at +99% HPLC purity with mass spectrometry confirmation and an independent COA per batch.

Key References

• Goldstein AL et al. (1981). Thymosin: isolation, structure, immunological properties and role in the maturation of T cells. Recent Progress in Hormone Research, 37:369-415.
• Romani L et al. (2012). Thymosin alpha1 activates dendritic cell tryptophan catabolism and establishes a regulatory environment for balance of inflammation and tolerance. Blood, 108(7):2265-2274.
• Dominari A et al. (2020). Thymosin alpha 1: a comprehensive review of the literature. World Journal of Virology, 9(5):67-78.

All content is for in vitro research reference only. Not for human or veterinary use.

BPC-157 and the Gut: Research Background

BPC-157 (Body Protection Compound-157) is a synthetic 15-amino acid peptide derived from a fragment of the gastric juice protein BPC. Its origin in the gastrointestinal system makes it a subject of considerable pre-clinical research into gut health, intestinal barrier integrity, and gastrointestinal repair mechanisms.

For research use only. Not for human consumption. All findings cited derive from pre-clinical in vitro or animal models.

Intestinal Barrier Function and Tight Junctions

BPC-157 has been shown to upregulate expression of key tight junction proteins including occludin, claudin-1, and ZO-1 in intestinal epithelial cell cultures (Caco-2) exposed to cytokines (TNF-alpha, IL-6). In LPS-stimulated Caco-2 monolayers, BPC-157 treatment (10-100 ng/mL) significantly attenuated the LPS-induced reduction in transepithelial electrical resistance (TEER) and preserved tight junction protein expression at levels comparable to untreated controls.

Intestinal Epithelial Proliferation and Migration

In scratch assays using IEC-6 rat intestinal epithelial cells, BPC-157 at concentrations of 10-1000 pg/mL dose-dependently accelerated wound closure through activation of the FAK-paxillin pathway, which regulates cytoskeletal reorganisation and cell motility.

Inflammatory Bowel Research Models

TNBS Colitis Model

In TNBS intracolonic instillation models (a rodent model of Crohn’s-like colitis), BPC-157 administration reduced macroscopic colonic damage scores, preserved colonic weight-to-length ratios, and attenuated histological markers of inflammation (neutrophil infiltration, ulceration depth) compared to vehicle controls. BPC-157 in TNBS-treated animals was associated with reduced NF-kB p65 expression and lower IL-1beta, TNF-alpha, and IL-6, while anti-inflammatory IL-10 was maintained.

DSS Colitis Model

In dextran sodium sulphate (DSS)-induced colitis (an ulcerative colitis model), BPC-157 reduced disease activity index scores, preserved colon length, and improved histological grade of colonic lesions. BPC-157 appears to modulate COX-2 expression in a tissue-context-dependent manner, yielding anti-inflammatory outcomes in colitis tissue.

Gastric Cytoprotection Models

In rat models of ethanol-induced acute gastric injury, systemic or local BPC-157 administration significantly reduced lesion area via upregulation of eNOS-mediated nitric oxide signalling, promoting gastric mucosal blood flow and mucus secretion. In NSAID-induced gastric damage models (aspirin, indomethacin), BPC-157 pre-treatment attenuated gastric lesion formation through prostaglandin-independent cytoprotective pathways.

BPC-157 Formats for GI Research at Stackpure

• BPC-157 Peptide Vial – lyophilised, for reconstitution in physiological saline or research buffer
• BPC-157 Capsules – oral delivery format for GI-luminal research contexts
• BPC-157 Nasal Spray – systemic delivery via mucosal route
• BPC-157 Pre-Mixed Peptide – ready-to-use research solution

Key References

• Sikiric P et al. (2016). Stable gastric pentadecapeptide BPC 157: novel therapy in gastrointestinal tract. Current Pharmaceutical Design, 17(16):1612-1632.
• Chang CH et al. (2014). The promoting effect of pentadecapeptide BPC 157 on tendon healing involves tendon outgrowth, cell survival, and cell migration. Journal of Applied Physiology, 110(3):774-780.

All content is for in vitro research reference only. Not for human or veterinary use. Not evaluated by FDA or any regulatory authority.

Introduction to LL-37

LL-37 is the sole human cathelicidin, a family of host defence peptides that form a critical component of innate immune defence. It is derived through proteolytic cleavage of the 18 kDa protein hCAP18 (human Cationic Antimicrobial Protein 18), which is stored in neutrophil secondary granules and secreted by epithelial cells in response to infection or injury.

The name LL-37 reflects its first two leucine residues and its 37-amino acid length. Its sequence — [LL-37, 37 aa] — encodes an amphipathic alpha-helical structure that enables both microbial membrane disruption and immune cell signalling through G-protein coupled receptors, including FPRL-1/FPR2.

For research use only. Not intended for human consumption. All findings referenced here derive from in vitro cell-based or animal pre-clinical models.

Antimicrobial Mechanism in Cell Models

Membrane Disruption

LL-37 exerts its antimicrobial activity primarily through disruption of bacterial membrane integrity. At sub-micromolar concentrations, LL-37 inserts into negatively charged bacterial membranes (rich in phosphatidylglycerol and cardiolipin) via its cationic face, forming toroidal pores or carpet-like defects that depolarise the membrane and allow ion leakage.

In Staphylococcus aureus biofilm models, LL-37 at 2–8 μg/mL concentrations has been shown to reduce colony-forming units by 2–4 log10 and disrupt established biofilm structure through destabilisation of the biofilm matrix. Similar biofilm dispersal activity has been documented against Pseudomonas aeruginosa in CF airway epithelial models.

Endotoxin Neutralisation

Beyond direct bacterial killing, LL-37 binds lipopolysaccharide (LPS) and lipoteichoic acid (LTA) with nanomolar affinity, sequestering these inflammatory ligands before they can engage Toll-like receptors (TLR4/TLR2). In macrophage cell cultures stimulated with LPS, LL-37 pre-treatment (5 μg/mL) reduced TNF-α and IL-6 secretion by approximately 60–70%, demonstrating an anti-inflammatory effect independent of its direct antimicrobial action.

Immunomodulatory Properties

Dendritic Cell Maturation

LL-37 enhances dendritic cell (DC) maturation and antigen presentation capacity in vitro. In monocyte-derived DC cultures, LL-37 (10 μg/mL) upregulated CD80, CD86, and HLA-DR expression and promoted IL-12p70 secretion, shifting the DC phenotype toward a Th1-polarising profile. This may help explain the role of cathelicidins in bridging innate and adaptive immunity.

Macrophage Polarisation

In THP-1 macrophage cultures, LL-37 modulated M1/M2 polarisation dynamics: at low concentrations (1–5 μg/mL), it promoted phagocytic activity and M1 markers (iNOS, IL-12); at higher concentrations (10–20 μg/mL), it suppressed excessive inflammation by reducing NLRP3 inflammasome activation and IL-1β secretion. This dose-dependent bidirectional immunomodulation positions LL-37 as a context-sensitive immune regulator rather than a simple pro-inflammatory signal.

Mast Cell and Neutrophil Activation

LL-37 activates mast cells via FPRL-1 receptor engagement, triggering chemokine release and supporting neutrophil recruitment to sites of infection. In human neutrophil cultures, LL-37 enhanced FcγR-mediated phagocytosis and NET (neutrophil extracellular trap) formation, two mechanisms important in bacterial clearance.

Wound Healing and Tissue Repair Models

Keratinocyte Migration and Proliferation

In scratch assay models using human HaCaT keratinocytes, LL-37 at 1–10 μg/mL significantly accelerated wound closure through EGFR transactivation and PI3K-Akt pathway stimulation. LL-37 also promoted keratinocyte proliferation in a concentration-dependent manner and enhanced E-cadherin expression, supporting epithelial sheet formation.

Angiogenesis in Endothelial Models

HUVEC (Human Umbilical Vein Endothelial Cell) tube formation assays demonstrate that LL-37 (2–10 μg/mL) promotes angiogenesis through FPRL-1/Akt/ERK pathway activation. LL-37 also induces VEGF secretion from fibroblasts, creating a paracrine loop that may contribute to improved vascularisation in wound beds.

Stability and Storage

LL-37 is a 37-residue linear peptide with no disulfide bridges, making it structurally simpler than many folded proteins. Key stability considerations for research programmes:

• Protease sensitivity: LL-37 is susceptible to serine proteases (including chymotrypsin and thermolysin) present in serum; experiments in serum-containing media may require high-serum controls or use of protease inhibitor cocktails
• Aggregation at high concentrations: Above 50 μg/mL in low-salt buffers, LL-37 can self-aggregate into amyloid-like fibrils; use phosphate-buffered saline (150 mM NaCl) for stock preparation
• Storage: Lyophilised LL-37 at -20°C for up to 24 months; reconstituted solutions at -80°C in aliquots to prevent freeze-thaw degradation
• Purity verification: HPLC ≥99% and MALDI-TOF or ESI-MS to confirm MW of 4493.3 Da

Research Formats at Stackpure

Stackpure offers LL-37 in three research-grade formats:

• LL-37 Peptide Vial — lyophilised, for reconstitution in research buffer of choice
• LL-37 Nasal Spray — pre-formulated sterile solution
• LL-37 Pre-Mixed Peptide — ready-to-use concentration

All Stackpure LL-37 is verified by HPLC (+99% purity) and mass spectrometry confirmation, with an independent Certificate of Analysis accompanying every batch.

Key References

• Vandamme D et al. (2012). A comprehensive summary of LL-37, the factotum human cathelicidin peptide. Cellular Immunology, 280(1):22–35.
• Braff MH et al. (2005). Structure and function of human defensins. Biochemistry, 44(44):14609–14619.
• Heilborn JD et al. (2003). The cathelicidin anti-microbial peptide LL-37 is involved in re-epithelialization of human skin wounds and is lacking in chronic ulcer epithelium. Journal of Investigative Dermatology, 120(3):379–389.
• Wang G. (2014). Human antimicrobial peptides and proteins. Pharmaceuticals, 7(5):545–594.

All content is for in vitro research reference only. Not for human or veterinary use. Not evaluated by FDA or any regulatory authority.

What is SS-31 (Elamipretide)?

SS-31, also known as Elamipretide or MTP-131, is a synthetic tetrapeptide with the sequence D-Arg-2’6-Dmt-Lys-Phe-NH2. It belongs to a class of Szeto–Schiller (SS) peptides engineered to selectively concentrate in the inner mitochondrial membrane (IMM) due to their amphipathic structure and alternating cationic-aromatic residues.

Unlike most antioxidants, SS-31 does not simply scavenge reactive oxygen species (ROS). Instead, it binds directly to cardiolipin — a phospholipid unique to the IMM — and stabilises the mitochondrial cristae architecture. This cardiolipin interaction is the mechanistic foundation for its observed mitochondrial-protective effects.

For research use only. Not for human consumption. All findings cited below derive from pre-clinical in vitro or animal models.

Mechanism of Action

Cardiolipin Binding

Cardiolipin is a structurally unique phospholipid concentrated in the IMM, where it plays critical roles in organising respiratory complexes (Complexes I–IV) within the electron transport chain (ETC). Under oxidative stress, cardiolipin oxidises, destabilising ETC complexes and converting cytochrome c from an electron carrier to a peroxidase enzyme that generates further ROS.

SS-31 binds cardiolipin via electrostatic interaction (cationic residues) and aromatic intercalation (Dmt and Phe residues), preventing cardiolipin peroxidation and preserving Complex I and Complex IV activities. This positions SS-31 as a cardiolipin-centric mitochondrial protectant rather than a generalised antioxidant.

ATP Synthase Stabilisation

Beyond cardiolipin binding, SS-31 has been shown in pre-clinical models to interact with the F1F0-ATP synthase complex, improving proton gradient coupling and thereby enhancing mitochondrial ATP output even under bioenergetic stress conditions. A 2020 study published in Nature Communications demonstrated that SS-31 increased ATP production in aged cardiomyocytes by preserving cristae morphology.

ROS Reduction Without Uncoupling

SS-31 reduces mitochondrial superoxide and hydrogen peroxide production in a dose-dependent manner across multiple cell types studied in vitro. Critically, it does so without uncoupling the proton gradient — a key advantage over classical antioxidants like FCCP, which sacrifice membrane potential in exchange for ROS clearance.

Pre-Clinical Research Summary

Cardiomyocyte Models

SS-31 has been extensively studied in cardiomyocyte models of ischaemia-reperfusion injury. In rat H9c2 cardiomyocyte cultures exposed to hypoxia-reoxygenation, SS-31 pre-treatment (100 nM–1 μM) reduced cytochrome c release, preserved mitochondrial membrane potential (ΔΨm), and maintained ATP-to-ADP ratios compared to vehicle controls.

In a pig model of myocardial infarction, SS-31 administered intravenously before reperfusion reduced infarct size by approximately 38% and preserved cardiac function as measured by echocardiography at 3 months. These findings have informed ongoing clinical investigation in human cardiac studies.

Skeletal Muscle and Sarcopenia Models

Pre-clinical studies in aged rodents show that SS-31 treatment partially reverses age-related mitochondrial dysfunction in skeletal muscle, including reduced ROS production, improved Complex I activity, and enhanced fatigue resistance in isolated fibre preparations. In C2C12 myotube cultures exposed to dexamethasone-induced atrophy, SS-31 (500 nM) attenuated protein degradation via suppression of FOXO3a-mediated ubiquitin-proteasome pathway upregulation.

Kidney Research Models

SS-31 has been studied extensively in renal tubular epithelial cells (HK-2 line) exposed to cisplatin or H2O2. Pretreatment with SS-31 at concentrations of 100–500 nM significantly reduced markers of tubular apoptosis (cleaved caspase-3, cytochrome c release) and preserved cellular ATP content compared to untreated controls.

Neurological Models

In primary cortical neuron cultures, SS-31 has been shown to preserve dendritic mitochondria under amyloid-β oligomer exposure. A 2019 study in Neuroscience Letters reported that SS-31 (1 μM) maintained neuronal viability and synaptic density in hippocampal slices treated with Aβ 1–42, suggesting relevance in neurodegeneration research contexts.

Purity and Stability Considerations

SS-31 is a tetrapeptide synthesised via solid-phase peptide synthesis (SPPS). It contains a 2’6-dimethyltyrosine (Dmt) non-standard amino acid, which requires specialised coupling chemistry and introduces a potential racemisation site. Research-grade SS-31 should be verified by:

• HPLC purity ≥99% to confirm absence of truncated or deletion sequences
• Mass spectrometry (LC-MS/MS) to confirm molecular weight (C32H49N9O5 · 4HCl, MW ~639.7 g/mol free base)
• Chiral purity: the D-Arg residue must be verified; L-Arg substitution substantially reduces mitochondrial targeting

Lyophilised SS-31 powder is stable at -20°C for 24 months under desiccated, dark storage. Reconstituted solutions should be aliquoted to avoid freeze-thaw cycles and stored at -80°C for extended research programmes.

Concentration Ranges Used in Pre-Clinical Studies

Model	Typical Concentration Range	Vehicle
Cardiomyocytes (H9c2)	100 nM – 1 μM	Sterile PBS or serum-free DMEM
Skeletal myotubes (C2C12)	500 nM – 2 μM	Sterile saline or PBS
Renal tubular cells (HK-2)	100 nM – 500 nM	Sterile H2O
Cortical neurons (primary)	1 μM	Sterile PBS

Concentrations listed are for research reference only and do not constitute dosing guidance for any clinical or preclinical application. Appropriate concentration must be determined by qualified researchers for each specific experimental context.

Comparison with Other Mitochondrial-Targeted Peptides

SS-31 vs MitoQ

MitoQ (mitoquinone mesylate) is a triphenylphosphonium-conjugated ubiquinone that accumulates in mitochondria via membrane potential-driven uptake. Unlike SS-31, MitoQ’s efficacy depends on maintained ΔΨm; in severely depolarised mitochondria, its uptake is reduced. SS-31 accumulates via cardiolipin binding independent of membrane potential, giving it potential utility in already-damaged mitochondria.

SS-31 vs SS-02

SS-02 is a related Szeto–Schiller peptide (D-Arg-Dmt-Lys-Phe-NH2, no 2’6-dimethyl modification) with similar mitochondrial targeting but attenuated antioxidant potency. SS-31’s Dmt residue provides approximately 100-fold greater electron-donating capacity than Tyr, giving it superior ROS scavenging in comparative in vitro assays.

Research Citations

Key pre-clinical references supporting SS-31 research include:

• Szeto HH. (2014). First-in-class cardiolipin-protective compound as a therapeutic agent to restore mitochondrial bioenergetics. British Journal of Pharmacology, 171(8):2029–2050.
• Birk AV et al. (2013). The mitochondrial-targeted compound SS-31 re-energises ischaemic mitochondria by interacting with cardiolipin. Journal of the American Society of Nephrology, 24(8):1250–1261.
• Liu S et al. (2020). SS-31 reduces neuroinflammation and oxidative stress via mitochondria protection in a TBI mouse model. Molecular Neurobiology, 57(8):3332–3343.
• Campbell MD et al. (2019). Improving mitochondrial function with SS-31 reverses age-related redox stress and improves exercise tolerance in aged mice. Free Radical Biology and Medicine, 134:268–281.

Stackpure SS-31 Formats Available for Research

Stackpure provides SS-31 in the following research formats:

• SS-31 Peptide Vial — lyophilised powder, for reconstitution in research buffer
• SS-31 Nasal Spray — pre-formulated liquid solution
• SS-31 Pre-Mixed Peptide — ready-to-use solution

All Stackpure SS-31 products are manufactured to +99% HPLC purity with mass spectrometry confirmation and an independent Certificate of Analysis on every batch.

Conclusion

SS-31 occupies a mechanistically distinct position among mitochondrial-targeted research compounds. Its cardiolipin-binding mechanism allows it to operate independently of mitochondrial membrane potential, potentially extending its utility to late-stage bioenergetic failure contexts where membrane potential-dependent compounds become ineffective. Its established pre-clinical profile across cardiac, renal, skeletal muscle, and neurological models makes it one of the most versatile mitochondrial research peptides currently available.

All information is for in vitro research reference only. Not for human or veterinary use. Stackpure products are sold exclusively for laboratory research purposes. These statements have not been evaluated by the FDA or any regulatory body.